PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_13622
Common NameKK1_014038
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family LBD
Protein Properties Length: 202aa    MW: 22331.4 Da    PI: 6.7383
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_13622genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260133.58.3e-42371361100
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    +CaaCk+lrr+Ca++Cvlapyfp ++p+kf  +h++FGasn++k+l++lpe +r da++s+vyeA ar+rdPvyG++g i +lq+q+++l+a+la+
  C.cajan_13622  37 PCAACKILRRRCAEKCVLAPYFPPTEPAKFTTAHRVFGASNIIKFLQELPEFQRADAVASMVYEASARIRDPVYGCAGAICQLQKQVNELQAQLAK 132
                    7*********************************************************************************************** PP

         DUF260  97 lkee 100
                    +++e
  C.cajan_13622 133 AQAE 136
                    9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.87936137IPR004883Lateral organ boundaries, LOB
PfamPF031953.0E-4237134IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
KFTKMKSDTN SPTSSPTFSH SSNNNIASSP PQVVMSPCAA CKILRRRCAE KCVLAPYFPP  60
TEPAKFTTAH RVFGASNIIK FLQELPEFQR ADAVASMVYE ASARIRDPVY GCAGAICQLQ  120
KQVNELQAQL AKAQAEVVDM QFQQANLLAL ISMEMSPTPQ ESPQQSVDNF ISSPSHSIDY  180
QNSCNFFEEM AKANLNSMWE PL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014497455.11e-114PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9SK081e-74LBD11_ARATH; LOB domain-containing protein 11
TrEMBLA0A151SV031e-149A0A151SV03_CAJCA; LOB domain-containing protein 11 (Fragment)
STRINGGLYMA13G40370.21e-112(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.12e-68LOB domain-containing protein 11